PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10009816m
Common NameCARUB_v10009816mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NAC
Protein Properties Length: 312aa    MW: 35068.2 Da    PI: 6.1057
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10009816mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.38.6e-51141391128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrF Ptdeel+v+yL+kk++g +++l + i+e+d+yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk + +
  Carubv10009816m  14 LPPGFRFYPTDEELMVQYLCKKAAGCDFSL-QLIAEIDLYKFDPWVLPSKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIIST 106
                      79**************************99.89***************8777899*********************************999988 PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +g+ vg+kk Lvfy g+apkg+kt+W+mheyrl
  Carubv10009816m 107 -EGQRVGIKKALVFYIGKAPKGTKTNWIMHEYRL 139
                      .999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-669162IPR003441NAC domain
PROSITE profilePS5100559.33314162IPR003441NAC domain
PfamPF023651.7E-2515139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MGLQETDPLV QLSLPPGFRF YPTDEELMVQ YLCKKAAGCD FSLQLIAEID LYKFDPWVLP  60
SKALFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIISTEGQR VGIKKALVFY  120
IGKAPKGTKT NWIMHEYRLI EPSRKNGSSK LDDWVLCRIY KKQSSAQKQV YENAITSGME  180
ISNNATSSTT SSSSHFEDVL DSFHHNEMDN RDFHFSNQNQ FSTLRPDLTE EKTGFNGLPE  240
TSSFGWGGFA GNVDQHNSVP ELGLSHVVPS LEYNCGYLKM EEEVESSHGF SNSGYGVNPV  300
GLEYSGRFGF M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-12011687174NAC domain-containing protein 19
3swm_B1e-12011687174NAC domain-containing protein 19
3swm_C1e-12011687174NAC domain-containing protein 19
3swm_D1e-12011687174NAC domain-containing protein 19
3swp_A1e-12011687174NAC domain-containing protein 19
3swp_B1e-12011687174NAC domain-containing protein 19
3swp_C1e-12011687174NAC domain-containing protein 19
3swp_D1e-12011687174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00012PBMTransfer from AT1G52890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0652680.0AY065268.1 Arabidopsis thaliana putative NAM protein (At1g52890) mRNA, complete cds.
GenBankAY1172240.0AY117224.1 Arabidopsis thaliana putative NAM protein (At1g52890) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006305416.10.0hypothetical protein CARUB_v10009816mg
SwissprotQ9C9320.0NAC19_ARATH; NAC domain-containing protein 19
TrEMBLR0I7K10.0R0I7K1_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.1__4367__AT1G52890.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14352795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G52890.10.0NAC domain containing protein 19